SCOP 1.63: Domain d1ktdc1: 1ktd C:82-182

Lineage for d1ktdc1 (1ktd C:82-182)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries)

8. Domain d1ktdc1: 1ktd C:82-182 [72968]
   Other proteins in same PDB: d1ktda2, d1ktdb2, d1ktdc2, d1ktdd2

Details for d1ktdc1

PDB Entry: 1ktd, 2.4 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to pigeon cytochrome c peptide

PDB Compounds: (C:)

SCOP Domain Sequences for d1ktdc1:

Sequence; same for both SEQRES and ATOM records:

>d1ktdc1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

Timeline for d1ktdc1:

• d1ktdc1 first appeared in SCOP 1.61
  
• d1ktdc1 appears in SCOP 1.65
  
• d1ktdc1 appears in the current release, SCOPe 2.07