| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1ktda1: 1ktd A:82-182 [72964] Other proteins in same PDB: d1ktda2, d1ktdb1, d1ktdb2, d1ktdc2, d1ktdd1, d1ktdd2 complexed with nag, so4 |
PDB Entry: 1ktd (more details), 2.4 Å
SCOPe Domain Sequences for d1ktda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktda1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1ktda1: