SCOPe 2.03: Domain d1ktba2: 1ktb A:1-293

Lineage for d1ktba2 (1ktb A:1-293)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [75065] (2 PDB entries)
   alpha-N-acetylgalactosaminidase

8. Domain d1ktba2: 1ktb A:1-293 [72961]
   Other proteins in same PDB: d1ktba1
   complexed with acy, gol, nag, so4

Details for d1ktba2

PDB Entry: 1ktb, 1.9 Å

PDB Description: the structure of alpha-n-acetylgalactosaminidase

PDB Compounds: (A:) alpha-N-acetylgalactosaminidase

SCOPe Domain Sequences for d1ktba2:

Sequence; same for both SEQRES and ATOM records:

>d1ktba2 c.1.8.1 (A:1-293) Melibiase {Chicken (Gallus gallus) [TaxId: 9031]}
lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini
ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld
rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl
ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii
gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdp

Timeline for d1ktba2:

• d1ktba2 first appeared in SCOP 1.61
  
• d1ktba2 appears in SCOPe 2.02
  
• d1ktba2 appears in SCOPe 2.04
  
• d1ktba2 appears in the current release, SCOPe 2.08