Lineage for d1kt9a_ (1kt9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971526Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 2971534Species Nematode (Caenorhabditis elegans) [TaxId:6239] [75526] (2 PDB entries)
  8. 2971537Domain d1kt9a_: 1kt9 A: [72959]

Details for d1kt9a_

PDB Entry: 1kt9 (more details), 1.98 Å

PDB Description: Crystal Structure of C. elegans Ap4A Hydrolase
PDB Compounds: (A:) Diadenosine Tetraphosphate Hydrolase

SCOPe Domain Sequences for d1kt9a_:

Sequence, based on SEQRES records: (download)

>d1kt9a_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mvvkaaglviyrklagkieflllqasypphhwtppkghvdpgedewqaairetkeeanit
keqltihedchetlfyeakgkpksvkywlaklnnpddvqlshehqnwkwceledaikiad
yaemgsllrkfsafla

Sequence, based on observed residues (ATOM records): (download)

>d1kt9a_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mvvkaaglviyrklagkieflllqaypphhwtppkghvdpgedewqaairetkeeanitk
eqltihedchetlfyeakgkpksvkywlaklnnpddvqlshnwkwceledaikiadyaem
gsllrkfsafla

SCOPe Domain Coordinates for d1kt9a_:

Click to download the PDB-style file with coordinates for d1kt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1kt9a_: