Lineage for d1kt2d2 (1kt2 D:2-120)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545542Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (10 PDB entries)
  8. 2545551Domain d1kt2d2: 1kt2 D:2-120 [72958]
    Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b1, d1kt2c1, d1kt2c2, d1kt2d1
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1kt2d2

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
PDB Compounds: (D:) Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k

SCOPe Domain Sequences for d1kt2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2d2 d.19.1.1 (D:2-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
adliaylkqatkggggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynle
enlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr

SCOPe Domain Coordinates for d1kt2d2:

Click to download the PDB-style file with coordinates for d1kt2d2.
(The format of our PDB-style files is described here.)

Timeline for d1kt2d2: