| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1kt2d1: 1kt2 D:121-215 [72957] Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b2, d1kt2c1, d1kt2c2, d1kt2d2 contains covalently bound peptides at the N-termini of chains B and D complexed with nag |
PDB Entry: 1kt2 (more details), 2.8 Å
SCOPe Domain Sequences for d1kt2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt2d1 b.1.1.2 (D:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew
Timeline for d1kt2d1: