SCOP 1.61: Domain d1kt2c1: 1kt2 C:82-182

Lineage for d1kt2c1 (1kt2 C:82-182)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries)

8. Domain d1kt2c1: 1kt2 C:82-182 [72955]
   Other proteins in same PDB: d1kt2a2, d1kt2b2, d1kt2c2, d1kt2d2

Details for d1kt2c1

PDB Entry: 1kt2, 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

SCOP Domain Sequences for d1kt2c1:

Sequence; same for both SEQRES and ATOM records:

>d1kt2c1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrkhwefee

Timeline for d1kt2c1:

• d1kt2c1 is new in SCOP 1.61
  
• d1kt2c1 appears in SCOP 1.63
  
• d1kt2c1 appears in the current release, SCOPe 2.08