SCOP 1.67: Domain d1kt2b1: 1kt2 B:121-215

Lineage for d1kt2b1 (1kt2 B:121-215)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1kt2b1: 1kt2 B:121-215 [72953]
   Other proteins in same PDB: d1kt2a1, d1kt2a2, d1kt2b2, d1kt2c1, d1kt2c2, d1kt2d2

Details for d1kt2b1

PDB Entry: 1kt2, 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide

SCOP Domain Sequences for d1kt2b1:

Sequence; same for both SEQRES and ATOM records:

>d1kt2b1 b.1.1.2 (B:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1kt2b1:

• d1kt2b1 first appeared in SCOP 1.61
  
• d1kt2b1 appears in SCOP 1.65
  
• d1kt2b1 appears in SCOP 1.69
  
• d1kt2b1 appears in the current release, SCOPe 2.08