Lineage for d1kt2a2 (1kt2 A:1-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642339Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1642454Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 1642469Domain d1kt2a2: 1kt2 A:1-81 [72952]
    Other proteins in same PDB: d1kt2a1, d1kt2b1, d1kt2b2, d1kt2c1, d1kt2d1, d1kt2d2
    complexed with nag

Details for d1kt2a2

PDB Entry: 1kt2 (more details), 2.8 Å

PDB Description: crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-D alpha chain

SCOPe Domain Sequences for d1kt2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt2a2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntp

SCOPe Domain Coordinates for d1kt2a2:

Click to download the PDB-style file with coordinates for d1kt2a2.
(The format of our PDB-style files is described here.)

Timeline for d1kt2a2: