SCOP 1.71: Domain d1ksxm_: 1ksx M:

Lineage for d1ksxm_ (1ksx M:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families)

5. Family d.89.1.2: Replication initiation protein E1 [64332] (1 protein)

6. Protein Replication initiation protein E1 [64333] (2 species)

7. Species Bovine papillomavirus [TaxId:10571] [64334] (3 PDB entries)

8. Domain d1ksxm_: 1ksx M: [72946]

Details for d1ksxm_

PDB Entry: 1ksx, 3.2 Å

PDB Description: Crystal Structures of Two Intermediates in the Assembly of the Papillomavirus Replication Initiation Complex

SCOP Domain Sequences for d1ksxm_:

Sequence; same for both SEQRES and ATOM records:

>d1ksxm_ d.89.1.2 (M:) Replication initiation protein E1 {Bovine papillomavirus}
atvfklglfkslflcsfhditrlfkndkttnqqwvlavfglaevffeasfellkkqcsfl
qmqkrsheggtcavylicfntaksretvrnlmanmlnvreeclmlqppkirglsaalfwf
ksslspatlkhgalpewiraqttln

Timeline for d1ksxm_:

• d1ksxm_ first appeared in SCOP 1.61
  
• d1ksxm_ appears in SCOP 1.69
  
• d1ksxm_ appears in SCOP 1.73
  
• d1ksxm_ appears in the current release, SCOPe 2.08