SCOPe 2.05: Domain d1ksva3: 1ksv A:1-59

Lineage for d1ksva3 (1ksv A:1-59)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
   automatically mapped to Pfam PF01479

6. Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)

7. Species Escherichia coli [TaxId:562] [75470] (3 PDB entries)

8. Domain d1ksva3: 1ksv A:1-59 [72939]
   Other proteins in same PDB: d1ksva4
   complexed with u

Details for d1ksva3

PDB Entry: 1ksv, 2.65 Å

PDB Description: structure of rsua

PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1ksva3:

Sequence; same for both SEQRES and ATOM records:

>d1ksva3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]}
mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg

Timeline for d1ksva3:

• d1ksva3 first appeared in SCOP 1.61
  
• d1ksva3 appears in SCOPe 2.04
  
• d1ksva3 appears in SCOPe 2.06
  
• d1ksva3 appears in the current release, SCOPe 2.08