Lineage for d1ksva3 (1ksv A:1-59)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956960Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
    automatically mapped to Pfam PF01479
  6. 2956961Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)
  7. 2956962Species Escherichia coli [TaxId:562] [75470] (3 PDB entries)
  8. 2956965Domain d1ksva3: 1ksv A:1-59 [72939]
    Other proteins in same PDB: d1ksva4
    complexed with u

Details for d1ksva3

PDB Entry: 1ksv (more details), 2.65 Å

PDB Description: structure of rsua
PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1ksva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksva3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]}
mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg

SCOPe Domain Coordinates for d1ksva3:

Click to download the PDB-style file with coordinates for d1ksva3.
(The format of our PDB-style files is described here.)

Timeline for d1ksva3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksva4