Lineage for d1ksub2 (1ksu B:103-359,B:506-568)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822671Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 822678Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 822679Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 822688Domain d1ksub2: 1ksu B:103-359,B:506-568 [72935]
    Other proteins in same PDB: d1ksua1, d1ksua3, d1ksub1, d1ksub3
    complexed with fad, fum, hem, na; mutant

Details for d1ksub2

PDB Entry: 1ksu (more details), 2 Å

PDB Description: crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (B:) flavocytochrome c

SCOP Domain Sequences for d1ksub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksub2 c.3.1.4 (B:103-359,B:506-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
ptiaelakdkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepvig
gnaklaaggmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdw
mtamgadltdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievl
kddkgtvkgilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgav
gdgldvaenaggalkdmXtmggvmidtkaevmnakkqvipglygagevtggvhganrlgg
naisdiitfgrlageeaakys

SCOP Domain Coordinates for d1ksub2:

Click to download the PDB-style file with coordinates for d1ksub2.
(The format of our PDB-style files is described here.)

Timeline for d1ksub2: