Lineage for d1ksub2 (1ksu B:103-359,B:506-568)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176176Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 176177Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 176345Family c.3.1.4: Succinate dehydrogenase/fumarate reductase N-terminal domain [51934] (4 proteins)
  6. 176352Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
  7. 176353Species Shewanella frigidimarina [TaxId:56812] [51941] (8 PDB entries)
  8. 176358Domain d1ksub2: 1ksu B:103-359,B:506-568 [72935]
    Other proteins in same PDB: d1ksua1, d1ksua3, d1ksub1, d1ksub3

Details for d1ksub2

PDB Entry: 1ksu (more details), 2 Å

PDB Description: crystal structure of his505tyr mutant flavocytochrome c3 from shewanella frigidimarina

SCOP Domain Sequences for d1ksub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksub2 c.3.1.4 (B:103-359,B:506-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina}
ptiaelakdkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepvig
gnaklaaggmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdw
mtamgadltdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievl
kddkgtvkgilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgav
gdgldvaenaggalkdmXtmggvmidtkaevmnakkqvipglygagevtggvhganrlgg
naisdiitfgrlageeaakys

SCOP Domain Coordinates for d1ksub2:

Click to download the PDB-style file with coordinates for d1ksub2.
(The format of our PDB-style files is described here.)

Timeline for d1ksub2: