Lineage for d1ksob_ (1kso B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.2: S100 proteins [47478] (1 protein) Protein Calcyclin (S100) [47479] (13 species) 
Species Human (Homo sapiens), s100a3 [TaxId:9606] [74720] (1 PDB entry) 
Domain d1ksob_: 1kso B: [72927]
Details for d1ksob_
PDB Entry: 1kso (more details), 1.7 Å
PDB Description: crystal structure of apo s100a3
SCOP Domain Sequences for d1ksob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksob_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100a3}
arpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfmsv
ldtnkdcevdfveyvrslaclclycheyfkdcp
SCOP Domain Coordinates for d1ksob_:
Click to download the PDB-style file with coordinates for d1ksob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksob_:
- d1ksob_ is new in SCOP 1.61
- d1ksob_ appears in SCOP 1.63
- d1ksob_ appears in the current release, SCOPe 2.08
View in 3D
