Lineage for d1ksla3 (1ksl A:1-59)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912489Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1912490Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1912583Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein)
    automatically mapped to Pfam PF01479
  6. 1912584Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species)
  7. 1912585Species Escherichia coli [TaxId:562] [75470] (3 PDB entries)
  8. 1912587Domain d1ksla3: 1ksl A:1-59 [72923]
    Other proteins in same PDB: d1ksla4
    complexed with ura

Details for d1ksla3

PDB Entry: 1ksl (more details), 2.1 Å

PDB Description: structure of rsua
PDB Compounds: (A:) ribosomal small subunit pseudouridine synthase a

SCOPe Domain Sequences for d1ksla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksla3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]}
mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg

SCOPe Domain Coordinates for d1ksla3:

Click to download the PDB-style file with coordinates for d1ksla3.
(The format of our PDB-style files is described here.)

Timeline for d1ksla3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ksla4