![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.5: Pseudouridine synthase RsuA N-terminal domain [75468] (1 protein) automatically mapped to Pfam PF01479 |
![]() | Protein Pseudouridine synthase RsuA N-terminal domain [75469] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [75470] (3 PDB entries) |
![]() | Domain d1kska3: 1ksk A:1-59 [72920] Other proteins in same PDB: d1kska4 complexed with ura |
PDB Entry: 1ksk (more details), 2 Å
SCOPe Domain Sequences for d1kska3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kska3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]} mrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqqhg
Timeline for d1kska3: