Lineage for d1ksja_ (1ksj A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein ADP-ribosylation factor [52614] (5 species) 
Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (3 PDB entries) 
Domain d1ksja_: 1ksj A: [72916]
Other proteins in same PDB: d1ksjb_
Details for d1ksja_
PDB Entry: 1ksj (more details), 2.6 Å
PDB Description: complex of arl2 and pde delta, crystal form 2 (semet)
SCOP Domain Sequences for d1ksja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksja_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
SCOP Domain Coordinates for d1ksja_:
Click to download the PDB-style file with coordinates for d1ksja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksja_:
- d1ksja_ is new in SCOP 1.61
- d1ksja_ appears in SCOP 1.63
- d1ksja_ appears in the current release, SCOPe 2.08
View in 3D
