| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) ![]() |
| Family c.37.1.8: G proteins [52592] (26 proteins) |
| Protein ADP-ribosylation factor [52614] (5 species) |
| Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (3 PDB entries) |
| Domain d1ksha_: 1ksh A: [72914] Other proteins in same PDB: d1kshb_ |
PDB Entry: 1ksh (more details), 1.8 Å
SCOP Domain Sequences for d1ksha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2}
relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
Timeline for d1ksha_: