Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (17 species) |
Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (6 PDB entries) |
Domain d1ksha_: 1ksh A: [72914] Other proteins in same PDB: d1kshb_ complexed with GMP-PDE delta complexed with gdp, mg, po4 |
PDB Entry: 1ksh (more details), 1.8 Å
SCOPe Domain Sequences for d1ksha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
Timeline for d1ksha_: