SCOPe 2.05: Domain d1ksgb_: 1ksg B:

Lineage for d1ksgb_ (1ksg B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (11 PDB entries)

8. Domain d1ksgb_: 1ksg B: [72913]
   Other proteins in same PDB: d1ksga_
   complexed with ARL2
   complexed with gtp, mg

Details for d1ksgb_

PDB Entry: 1ksg, 2.3 Å

PDB Description: complex of arl2 and pde delta, crystal form 1

PDB Compounds: (B:) retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase delta-subunit

SCOPe Domain Sequences for d1ksgb_:

Sequence, based on SEQRES records:

>d1ksgb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvl
tgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records):

>d1ksgb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliietkffdddllvst
srvrlfyv

Timeline for d1ksgb_:

• d1ksgb_ first appeared in SCOP 1.61
  
• d1ksgb_ appears in SCOPe 2.04
  
• d1ksgb_ appears in SCOPe 2.06
  
• d1ksgb_ appears in the current release, SCOPe 2.08