SCOP 1.63: Domain d1ksga_: 1ksg A:

Lineage for d1ksga_ (1ksg A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (7 species)

7. Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (3 PDB entries)

8. Domain d1ksga_: 1ksg A: [72912]
   Other proteins in same PDB: d1ksgb_
   complexed with GMP-PDE delta
   complexed with gtp, mg; mutant

Details for d1ksga_

PDB Entry: 1ksg, 2.3 Å

PDB Description: complex of arl2 and pde delta, crystal form 1

SCOP Domain Sequences for d1ksga_:

Sequence; same for both SEQRES and ATOM records:

>d1ksga_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2}
smglltilkkmkqkerelrllmlgldnagkttilkkfngedvdtisptlgfniktlehrg
fklniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagat
llifankqdlpgalscnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr

Timeline for d1ksga_:

• d1ksga_ first appeared in SCOP 1.61
  
• d1ksga_ appears in SCOP 1.65
  
• d1ksga_ appears in the current release, SCOPe 2.08, called d1ksga1