Lineage for d1ks2b2 (1ks2 B:127-198)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 193084Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 193085Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 193086Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (2 species)
  7. 193096Species Escherichia coli [TaxId:562] [75448] (2 PDB entries)
  8. 193098Domain d1ks2b2: 1ks2 B:127-198 [72911]
    Other proteins in same PDB: d1ks2a1, d1ks2b1

Details for d1ks2b2

PDB Entry: 1ks2 (more details), 1.5 Å

PDB Description: crystal structure analysis of the rpia, structural genomics, protein ec1268.

SCOP Domain Sequences for d1ks2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks2b2 d.58.40.1 (B:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

SCOP Domain Coordinates for d1ks2b2:

Click to download the PDB-style file with coordinates for d1ks2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ks2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ks2b1