Lineage for d1ks2a2 (1ks2 A:127-198)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258276Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 258277Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 258278Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (3 species)
  7. 258288Species Escherichia coli [TaxId:562] [75448] (3 PDB entries)
  8. 258291Domain d1ks2a2: 1ks2 A:127-198 [72909]
    Other proteins in same PDB: d1ks2a1, d1ks2b1

Details for d1ks2a2

PDB Entry: 1ks2 (more details), 1.5 Å

PDB Description: crystal structure analysis of the rpia, structural genomics, protein ec1268.

SCOP Domain Sequences for d1ks2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks2a2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

SCOP Domain Coordinates for d1ks2a2:

Click to download the PDB-style file with coordinates for d1ks2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ks2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ks2a1