Lineage for d1ks2a1 (1ks2 A:2-126,A:199-219)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312934Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 312935Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
    share a common phosphate-binding site
  5. 312955Family c.35.1.2: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
  6. 312956Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (3 species)
  7. 312966Species Escherichia coli [TaxId:562] [75178] (3 PDB entries)
  8. 312969Domain d1ks2a1: 1ks2 A:2-126,A:199-219 [72908]
    Other proteins in same PDB: d1ks2a2, d1ks2b2

Details for d1ks2a1

PDB Entry: 1ks2 (more details), 1.5 Å

PDB Description: crystal structure analysis of the rpia, structural genomics, protein ec1268.

SCOP Domain Sequences for d1ks2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks2a1 c.35.1.2 (A:2-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli}
tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
qvdilXanrgadvaligtpdgvktivk

SCOP Domain Coordinates for d1ks2a1:

Click to download the PDB-style file with coordinates for d1ks2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ks2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ks2a2