Lineage for d1krrb_ (1krr B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809539Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 809540Protein Galactoside acetyltransferase [75028] (1 species)
  7. 809541Species Escherichia coli [TaxId:562] [75029] (4 PDB entries)
  8. 809543Domain d1krrb_: 1krr B: [72900]

Details for d1krrb_

PDB Entry: 1krr (more details), 2.5 Å

PDB Description: galactoside acetyltransferase in complex with acetyl-coenzyme a
PDB Compounds: (B:) galactoside o-acetyltransferase

SCOP Domain Sequences for d1krrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krrb_ b.81.1.3 (B:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}
nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
ireindrdkhyyfkdykves

SCOP Domain Coordinates for d1krrb_:

Click to download the PDB-style file with coordinates for d1krrb_.
(The format of our PDB-style files is described here.)

Timeline for d1krrb_: