Lineage for d1krra_ (1krr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2813893Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 2813894Protein Galactoside acetyltransferase [75028] (1 species)
  7. 2813895Species Escherichia coli [TaxId:562] [75029] (4 PDB entries)
  8. 2813899Domain d1krra_: 1krr A: [72899]
    complexed with aco

Details for d1krra_

PDB Entry: 1krr (more details), 2.5 Å

PDB Description: galactoside acetyltransferase in complex with acetyl-coenzyme a
PDB Compounds: (A:) galactoside o-acetyltransferase

SCOPe Domain Sequences for d1krra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]}
nmpmteriragklftdmceglpekrlrgktlmyefnhshpsevekreslikemfatvgen
awveppvyfsygsnihigrnfyanfnltivddytvtigdnvliapnvtlsvtghpvhhel
rkngemysfpitignnvwigshvvinpgvtigdnsvigagsivtkdippnvvaagvpcrv
ireindrdkhyyfkdykves

SCOPe Domain Coordinates for d1krra_:

Click to download the PDB-style file with coordinates for d1krra_.
(The format of our PDB-style files is described here.)

Timeline for d1krra_: