Lineage for d1kria_ (1kri A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051601Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2051602Protein vp4 sialic acid binding domain [74908] (1 species)
  7. 2051603Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries)
  8. 2051609Domain d1kria_: 1kri A: [72897]

Details for d1kria_

PDB Entry: 1kri (more details)

PDB Description: nmr solution structures of the rhesus rotavirus vp4 sialic acid binding domain without ligand
PDB Compounds: (A:) vp4

SCOPe Domain Sequences for d1kria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kria_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
ldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfgt
qeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpnv
ttkyysttnydsvnmtafcdfyiipreeestcteyinngl

SCOPe Domain Coordinates for d1kria_:

Click to download the PDB-style file with coordinates for d1kria_.
(The format of our PDB-style files is described here.)

Timeline for d1kria_: