Lineage for d1krhb3 (1krh B:2-105)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179355Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2179378Protein Benzoate dioxygenase reductase, N-terminal domain [75368] (1 species)
  7. 2179379Species Acinetobacter sp. [TaxId:472] [75369] (1 PDB entry)
  8. 2179381Domain d1krhb3: 1krh B:2-105 [72896]
    Other proteins in same PDB: d1krha1, d1krha2, d1krhb1, d1krhb2
    CASP4
    complexed with fad, fes, so4

Details for d1krhb3

PDB Entry: 1krh (more details), 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase
PDB Compounds: (B:) Benzoate 1,2-Dioxygenase Reductase

SCOPe Domain Sequences for d1krhb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krhb3 d.15.4.2 (B:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]}
snhqvalqfedgvtrficiaqgetlsdaayrqqinipmdcregecgtcrafcesgnydmp
ednyiedaltpeeaqqgyvlacqcrptsdavfqiqassevcktk

SCOPe Domain Coordinates for d1krhb3:

Click to download the PDB-style file with coordinates for d1krhb3.
(The format of our PDB-style files is described here.)

Timeline for d1krhb3: