Lineage for d1krhb3 (1krh B:2-105)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189382Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 189463Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (9 proteins)
  6. 189469Protein Benzoate dioxygenase reductase, N-terminal domain [75368] (1 species)
  7. 189470Species Acinetobacter sp. [75369] (1 PDB entry)
  8. 189472Domain d1krhb3: 1krh B:2-105 [72896]
    Other proteins in same PDB: d1krha1, d1krha2, d1krhb1, d1krhb2

Details for d1krhb3

PDB Entry: 1krh (more details), 1.5 Å

PDB Description: x-ray structure of benzoate dioxygenase reductase

SCOP Domain Sequences for d1krhb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krhb3 d.15.4.2 (B:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp.}
snhqvalqfedgvtrficiaqgetlsdaayrqqinipmdcregecgtcrafcesgnydmp
ednyiedaltpeeaqqgyvlacqcrptsdavfqiqassevcktk

SCOP Domain Coordinates for d1krhb3:

Click to download the PDB-style file with coordinates for d1krhb3.
(The format of our PDB-style files is described here.)

Timeline for d1krhb3: