![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (2 proteins) lack the first helix but otherwise is more similar to conventional globins than the truncated ones automatically mapped to Pfam PF00042 |
![]() | Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species) |
![]() | Species Milky ribbon worm (Cerebratulus lacteus) [TaxId:6221] [74662] (13 PDB entries) Uniprot O76242 |
![]() | Domain d1kr7a_: 1kr7 A: [72890] complexed with act, hem, oxy, so4 |
PDB Entry: 1kr7 (more details), 1.5 Å
SCOPe Domain Sequences for d1kr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]} mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl
Timeline for d1kr7a_: