Lineage for d1kr7a_ (1kr7 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 209566Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (1 protein)
    lack the first helix but otherwise is more similar to conventional globins than the truncated ones
  6. 209567Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species)
  7. 209568Species Milky ribbon-worm (Cerebratulus lacteus) [TaxId:6221] [74662] (1 PDB entry)
  8. 209569Domain d1kr7a_: 1kr7 A: [72890]
    complexed with act, hem, oxy, so4

Details for d1kr7a_

PDB Entry: 1kr7 (more details), 1.5 Å

PDB Description: Crystal structure of the nerve tissue mini-hemoglobin from the nemertean worm Cerebratulus lacteus

SCOP Domain Sequences for d1kr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus)}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl

SCOP Domain Coordinates for d1kr7a_:

Click to download the PDB-style file with coordinates for d1kr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr7a_: