Lineage for d1kr7a_ (1kr7 A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.4: Nerve tissue mini-hemoglobin (neural globin) [74660] (1 protein) Protein Nerve tissue mini-hemoglobin (neural globin) [74661] (1 species) Species Milky ribbon-worm (Cerebratulus lacteus) [TaxId:6221] [74662] (1 PDB entry) 
Domain d1kr7a_: 1kr7 A: [72890]
Details for d1kr7a_
PDB Entry: 1kr7 (more details), 1.5 Å
PDB Description: Crystal structure of the nerve tissue mini-hemoglobin from the nemertean worm Cerebratulus lacteus
SCOP Domain Sequences for d1kr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus)}
mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl
SCOP Domain Coordinates for d1kr7a_:
Click to download the PDB-style file with coordinates for d1kr7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kr7a_:
- d1kr7a_ is new in SCOP 1.61
- d1kr7a_ appears in SCOP 1.63
- d1kr7a_ appears in the current release, SCOPe 2.08
View in 3D