SCOP 1.69: Domain d1kr4a_: 1kr4 A:

Lineage for d1kr4a_ (1kr4 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Hypothetical protein TM1056 [75435] (1 species)

7. Species Thermotoga martima [75436] (3 PDB entries)

8. Domain d1kr4a_: 1kr4 A: [72889]
   structural genomics

Details for d1kr4a_

PDB Entry: 1kr4, 1.4 Å

PDB Description: structure genomics, protein tm1056, cuta

SCOP Domain Sequences for d1kr4a_:

Sequence; same for both SEQRES and ATOM records:

>d1kr4a_ d.58.5.2 (A:) Hypothetical protein TM1056 {Thermotoga martima}
alyfmghmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaa
ifktteekekelyeelrklhpyetpaiftlkvenilteymnwlresvlgs

Timeline for d1kr4a_:

• d1kr4a_ first appeared in SCOP 1.61
  
• d1kr4a_ appears in SCOP 1.67
  
• d1kr4a_ appears in SCOP 1.71
  
• d1kr4a_ appears in the current release, SCOPe 2.08, called d1kr4a1