Lineage for d1kr4a_ (1kr4 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504343Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 504374Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 504393Protein Hypothetical protein TM1056 [75435] (1 species)
  7. 504394Species Thermotoga martima [75436] (3 PDB entries)
  8. 504395Domain d1kr4a_: 1kr4 A: [72889]
    structural genomics

Details for d1kr4a_

PDB Entry: 1kr4 (more details), 1.4 Å

PDB Description: structure genomics, protein tm1056, cuta

SCOP Domain Sequences for d1kr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr4a_ d.58.5.2 (A:) Hypothetical protein TM1056 {Thermotoga martima}
alyfmghmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaa
ifktteekekelyeelrklhpyetpaiftlkvenilteymnwlresvlgs

SCOP Domain Coordinates for d1kr4a_:

Click to download the PDB-style file with coordinates for d1kr4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr4a_: