| Class b: All beta proteins [48724] (178 folds) |
| Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
| Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
| Protein Cellular retinol-binding protein II (CRBP) [50864] (2 species) |
| Species Zebrafish (Danio rerio) [TaxId:7955] [75000] (2 PDB entries) |
| Domain d1kqxa_: 1kqx A: [72888] |
PDB Entry: 1kqx (more details), 1.7 Å
SCOPe Domain Sequences for d1kqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqxa_ b.60.1.2 (A:) Cellular retinol-binding protein II (CRBP) {Zebrafish (Danio rerio) [TaxId: 7955]}
padfngtwemlsndnfedvmkaldidfatrkiavhlkqtkvivqngdkfetktlstfrny
evnfvigeefdeqtkgldnrtvktlvkwdgdklvcvqkgekenrgwkqwiegdllhleih
cqdkvchqvfkkkn
Timeline for d1kqxa_: