Lineage for d1kqpb_ (1kqp B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392401Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 392402Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 392471Protein NH3-dependent NAD+-synthetase [52406] (1 species)
  7. 392472Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)
  8. 392474Domain d1kqpb_: 1kqp B: [72884]
    complexed with adj, edo, mg, pop

Details for d1kqpb_

PDB Entry: 1kqp (more details), 1.03 Å

PDB Description: nh3-dependent nad+ synthetase from bacillus subtilis at 1 a resolution

SCOP Domain Sequences for d1kqpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqpb_ c.26.2.1 (B:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

SCOP Domain Coordinates for d1kqpb_:

Click to download the PDB-style file with coordinates for d1kqpb_.
(The format of our PDB-style files is described here.)

Timeline for d1kqpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kqpa_