Lineage for d1kqpa_ (1kqp A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842254Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 1842340Protein NH3-dependent NAD+-synthetase [52406] (4 species)
  7. 1842350Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries)
  8. 1842351Domain d1kqpa_: 1kqp A: [72883]
    complexed with adj, edo, mg, pop

Details for d1kqpa_

PDB Entry: 1kqp (more details), 1.03 Å

PDB Description: nh3-dependent nad+ synthetase from bacillus subtilis at 1 a resolution
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d1kqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk

SCOPe Domain Coordinates for d1kqpa_:

Click to download the PDB-style file with coordinates for d1kqpa_.
(The format of our PDB-style files is described here.)

Timeline for d1kqpa_: