Lineage for d1kqpa_ (1kqp A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) Superfamily c.26.2: Adenine nucleotide alpha hydrolases [52402] (2 families) 
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (5 proteins) Protein NH3-dependent NAD+-synthetase [52406] (1 species) Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries) 
Domain d1kqpa_: 1kqp A: [72883]
Details for d1kqpa_
PDB Entry: 1kqp (more details), 1.03 Å
PDB Description: nh3-dependent nad+ synthetase from bacillus subtilis at 1 a resolution
SCOP Domain Sequences for d1kqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis}
smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql
avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq
etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp
ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev
sakvsealekrysmtehkrqvpasmfddwwk
SCOP Domain Coordinates for d1kqpa_:
Click to download the PDB-style file with coordinates for d1kqpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kqpa_:
- d1kqpa_ is new in SCOP 1.61
- d1kqpa_ appears in SCOP 1.63
- d1kqpa_ appears in the current release, SCOPe 2.08
View in 3D
