Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
Protein NH3-dependent NAD+-synthetase [52406] (4 species) |
Species Bacillus subtilis [TaxId:1423] [52407] (7 PDB entries) |
Domain d1kqpa_: 1kqp A: [72883] complexed with adj, edo, mg, pop has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1kqp (more details), 1.03 Å
SCOPe Domain Sequences for d1kqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} smqekimrelhvkpsidpkqeiedrvnflkqyvkktgakgfvlgisggqdstlagrlaql avesireeggdaqfiavrlphgtqqdeddaqlalkfikpdkswkfdikstvsafsdqyqq etgdqltdfnkgnvkartrmiaqyaiggqegllvlgtdhaaeavtgfftkygdggadllp ltgltkrqgrtllkelgaperlylkeptadlldekpqqsdetelgisydeiddylegkev sakvsealekrysmtehkrqvpasmfddwwk
Timeline for d1kqpa_: