SCOP 1.75: Domain d1kqja_: 1kqj A:

Lineage for d1kqja_ (1kqj A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
   Uniprot P17802 1-225

8. Domain d1kqja_: 1kqj A: [72879]
   complexed with cry, fs4, so4; mutant

Details for d1kqja_

PDB Entry: 1kqj, 1.7 Å

PDB Description: crystal structure of a mutant of muty catalytic domain

PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOP Domain Sequences for d1kqja_:

Sequence; same for both SEQRES and ATOM records:

>d1kqja_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkhslcplqngciaaannswalypgkkpk

Timeline for d1kqja_:

• d1kqja_ first appeared in SCOP 1.61
  
• d1kqja_ appears in SCOP 1.73
  
• d1kqja_ appears in SCOPe 2.01
  
• d1kqja_ appears in the current release, SCOPe 2.08