Lineage for d1kqga2 (1kqg A:34-850)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140568Protein Formate dehydrogenase N, alpha subunit [75317] (1 species)
  7. 2140569Species Escherichia coli [TaxId:562] [75318] (2 PDB entries)
  8. 2140571Domain d1kqga2: 1kqg A:34-850 [72876]
    Other proteins in same PDB: d1kqga1, d1kqgb1, d1kqgb2, d1kqgc_
    complexed with 6mo, cdl, hem, hqo, mgd, sf4

Details for d1kqga2

PDB Entry: 1kqg (more details), 2.8 Å

PDB Description: formate dehydrogenase n from e. coli
PDB Compounds: (A:) formate dehydrogenase, nitrate-inducible, major subunit

SCOPe Domain Sequences for d1kqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqga2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]}
qarnykllrakeirntctycsvgcgllmyslgdgaknareaiyhiegdpdhpvsrgalcp
kgaglldyvnsenrlrypeyrapgsdkwqrisweeafsriaklmkadrdanfiekneqgv
tvnrwlstgmlcasgasnetgmltqkfarslgmlavdnqarvahgptvaslaptfgrgam
tnhwvdiknanvvmvmggnaaeahpvgfrwameaknnndatlivvdprftrtasvadiya
pirsgtditflsgvlryliennkinaeyvkhytnasllvrddfafedglfsgydaekrqy
dksswnyqldengyakrdetlthprcvwnllkehvsrytpdvvenicgtpkadflkvcev
lastsapdrtttflyalgwtqhtvgaqnirtmamiqlllgnmgmagggvnalrghsniqg
ltdlgllstslpgyltlpsekqvdlqsyleantpkatladqvnywsnypkffvslmksfy
gdaaqkennwgydwlpkwdqtydvikyfnmmdegkvtgyfcqgfnpvasfpdknkvvscl
sklkymvvidplvtetstfwqnhgesndvdpasiqtevfrlpstcfaeedgsiansgrwl
qwhwkgqdapgearndgeilagiyhhlrelyqseggkgveplmkmswnykqphepqsdev
akenngyaledlydangvliakkgqllssfahlrddgttasscwiytgswteqgnqmanr
dnsdpsglgntlgwawawplnrrvlynrasadingkpwdpkrmliqwngskwtgndipdf
gnaapgtptgpfimqpegmgrlfainkmaegpfpehy

SCOPe Domain Coordinates for d1kqga2:

Click to download the PDB-style file with coordinates for d1kqga2.
(The format of our PDB-style files is described here.)

Timeline for d1kqga2: