SCOP 1.73: Domain d1kq2m_: 1kq2 M:

Lineage for d1kq2m_ (1kq2 M:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.38: Sm-like fold [50181] (3 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families)

5. Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
   forms homohexameric ring structures

6. Protein Pleiotropic translational regulator Hfq [74940] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)

8. Domain d1kq2m_: 1kq2 M: [72865]

Details for d1kq2m_

PDB Entry: 1kq2, 2.71 Å

PDB Description: Crystal Structure of an Hfq-RNA Complex

PDB Compounds: (M:) Host Factor for Q beta

SCOP Domain Sequences for d1kq2m_:

Sequence; same for both SEQRES and ATOM records:

>d1kq2m_ b.38.1.2 (M:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

Timeline for d1kq2m_:

• d1kq2m_ first appeared in SCOP 1.61
  
• d1kq2m_ appears in SCOP 1.71
  
• d1kq2m_ appears in SCOP 1.75
  
• d1kq2m_ appears in the current release, SCOPe 2.08