Lineage for d1kq2h_ (1kq2 H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166075Fold b.38: Sm-like fold [50181] (2 superfamilies)
  4. 166076Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families) (S)
  5. 166176Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
  6. 166177Protein Pleiotropic translational regulator Hfq [74940] (1 species)
  7. 166178Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)
  8. 166193Domain d1kq2h_: 1kq2 H: [72862]

Details for d1kq2h_

PDB Entry: 1kq2 (more details), 2.71 Å

PDB Description: Crystal Structure of an Hfq-RNA Complex

SCOP Domain Sequences for d1kq2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq2h_ b.38.1.2 (H:) Pleiotropic translational regulator Hfq {Staphylococcus aureus}
eniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistyt
ve

SCOP Domain Coordinates for d1kq2h_:

Click to download the PDB-style file with coordinates for d1kq2h_.
(The format of our PDB-style files is described here.)

Timeline for d1kq2h_: