![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.38: Sm-like fold [50181] (3 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) ![]() |
![]() | Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein) forms homohexameric ring structures |
![]() | Protein Pleiotropic translational regulator Hfq [74940] (3 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries) |
![]() | Domain d1kq1w_: 1kq1 W: [72858] complexed with acy |
PDB Entry: 1kq1 (more details), 1.55 Å
SCOP Domain Sequences for d1kq1w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kq1w_ b.38.1.2 (W:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv e
Timeline for d1kq1w_: