Lineage for d1kq1t_ (1kq1 T:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558695Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 558696Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 558927Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 558928Protein Pleiotropic translational regulator Hfq [74940] (2 species)
  7. 558936Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)
  8. 558946Domain d1kq1t_: 1kq1 T: [72857]

Details for d1kq1t_

PDB Entry: 1kq1 (more details), 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq

SCOP Domain Sequences for d1kq1t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq1t_ b.38.1.2 (T:) Pleiotropic translational regulator Hfq {Staphylococcus aureus}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

SCOP Domain Coordinates for d1kq1t_:

Click to download the PDB-style file with coordinates for d1kq1t_.
(The format of our PDB-style files is described here.)

Timeline for d1kq1t_: