Lineage for d1kq1k_ (1kq1 K:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 667162Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 667163Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 667184Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)
  8. 667189Domain d1kq1k_: 1kq1 K: [72852]

Details for d1kq1k_

PDB Entry: 1kq1 (more details), 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq
PDB Compounds: (K:) Host Factor for Q beta

SCOP Domain Sequences for d1kq1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq1k_ b.38.1.2 (K:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

SCOP Domain Coordinates for d1kq1k_:

Click to download the PDB-style file with coordinates for d1kq1k_.
(The format of our PDB-style files is described here.)

Timeline for d1kq1k_: