Lineage for d1kq1b_ (1kq1 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (1 protein)
    forms homohexameric ring structures
  6. 798430Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 798451Species Staphylococcus aureus [TaxId:1280] [74941] (2 PDB entries)
  8. 798453Domain d1kq1b_: 1kq1 B: [72849]

Details for d1kq1b_

PDB Entry: 1kq1 (more details), 1.55 Å

PDB Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq
PDB Compounds: (B:) Host Factor for Q beta

SCOP Domain Sequences for d1kq1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq1b_ b.38.1.2 (B:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]}
niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
e

SCOP Domain Coordinates for d1kq1b_:

Click to download the PDB-style file with coordinates for d1kq1b_.
(The format of our PDB-style files is described here.)

Timeline for d1kq1b_: