Lineage for d1kpqa_ (1kpq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898628Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 1898629Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 1898630Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)
  8. 1898642Domain d1kpqa_: 1kpq A: [72847]

Details for d1kpqa_

PDB Entry: 1kpq (more details)

PDB Description: structure of the tsg101 uev domain
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1kpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpqa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d1kpqa_:

Click to download the PDB-style file with coordinates for d1kpqa_.
(The format of our PDB-style files is described here.)

Timeline for d1kpqa_: