Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (2 families) |
Family d.20.1.2: UEV domain [75383] (2 proteins) |
Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75385] (5 PDB entries) |
Domain d1kpqa_: 1kpq A: [72847] |
PDB Entry: 1kpq (more details)
SCOP Domain Sequences for d1kpqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpqa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens)} avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq sdllgliqvmivvfgdeppvfsrp
Timeline for d1kpqa_: