Lineage for d1kpqa_ (1kpq A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327088Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 327089Superfamily d.20.1: UBC-like [54495] (2 families) (S)
  5. 327133Family d.20.1.2: Tumor susceptibility gene 101 (TSG101) UEV domain [75383] (1 protein)
  6. 327134Protein Tumor susceptibility gene 101 (TSG101) UEV domain [75384] (1 species)
  7. 327135Species Human (Homo sapiens) [TaxId:9606] [75385] (4 PDB entries)
  8. 327137Domain d1kpqa_: 1kpq A: [72847]

Details for d1kpqa_

PDB Entry: 1kpq (more details)

PDB Description: structure of the tsg101 uev domain

SCOP Domain Sequences for d1kpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpqa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) UEV domain {Human (Homo sapiens)}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
sdllgliqvmivvfgdeppvfsrp

SCOP Domain Coordinates for d1kpqa_:

Click to download the PDB-style file with coordinates for d1kpqa_.
(The format of our PDB-style files is described here.)

Timeline for d1kpqa_: